*Target (protein/gene name): protein-tyrosine-phosphatase A (ptpA)

*NCBI Gene # or RefSeq#: 887373

*Protein ID (NP or XP #) or Wolbachia#: NP_216750.1

*Organism (including strain): Mycobacterium tuberculosis

Etiologic Risk Group (see link below): Category C Priority Pathogens

*/Disease Information (sort of like the Intro to your Mini Research Write up):
Tuberculosis (TB) is a widespread and potentially fatal disease caused by Mycobacterium tuberculosis. TB usually attacks the lungs but can also affect other parts of the body such as the kidney, spine, and brain. It is transmitted through the air when one individual coughs out the bacteria and other individuals breathe the bacteria in. There are two forms of TB: Latent TB infection and TB disease. Individuals with latent TB infection do not feel sick or show any symptoms and most do not for their entire lives. On the other hand, patients with TB disease are sick and show the symptoms of a terrible cough, bloody cough, loss of appetite, fevers, and chills. One third of the world’s population is infected with TB and is the leading killer of people who are HIV infected.

Link to TDR Targets page (if present): N/A

Link to Gene Database page (NCBI, EuPath databases -e.g. TryTryp, PlasmoDB, etc - or PATRIC, etc.)
http://www.ncbi.nlm.nih.gov/gene/?term=NP_216750.1

Essentiality of this protein: Needed for Mtb survival and pathogenicity within host macrophages.
http://www.ncbi.nlm.nih.gov/pubmed/22087003

Is it a monomer or multimer as biological unit? Monomer

Complex of proteins?: N/A

Druggable Target (list number or cite evidence from a paper/database showing druggable in another organism): http://www.ncbi.nlm.nih.gov/pubmed/22087003

*EC#: 3.1.3.48
Link to BRENDA EC# page: http://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.48&Suchword=&organism%5B%5D=Mycobacterium+tuberculosis&show_tm=0

-- Show screenshot of BRENDA enzyme mechanism schematic
Screen Shot 2015-04-20 at 2.39.15 PM.png
Enzyme Assay information (spectrophotometric, coupled assay ?, reagents):
http://www.nature.com/cr/journal/v24/n2/full/cr2013138a.html

Structure (PDB or Homology model)
-- PDB #: 1U2Q

Current Inhibitors: positions of the two methoxyl groups at the A-ring
http://www.ncbi.nlm.nih.gov/pubmed/20462762

Expression Information (has it been expressed in bacterial cells): Expressed in Mycobacterium tuberculosis.

Purification Method: Affinity chromatography using Ni-NTA resin (QIAGEN)
http://iai.asm.org/content/74/12/6540.full

Image of protein (PyMol with features delineated and shown separately

Screen Shot 2015-04-21 at 1.04.55 AM.png

*Amino Acid Sequence (paste as txt only - not as screenshot or as 'code'):
MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS

*length of your protein in Amino Acids: 163 aa

Molecular Weight of your protein in kiloDaltons using the **Expasy ProtParam** website: 17892.0 Da or 17.892 kDa

Molar Extinction coefficient of your protein at 280 nm wavelength: 15580 cm^-1 M^-1

TMpred graph Image (http://www.ch.embnet.org/software/TMPRED_form.html). Input your amino acid sequence to it.
TMPRED.28725.2311.gif
*CDS Gene Sequence (paste as text only): GTGTCTGATCCGCTGCACGTCACATTCGTTTGTACGGGCAACATCTGCCGGTCGCCAATGGCCGAGAAGATGTTCGCCCAACAGCTTCGCCACCGTGGCCTGGGTGACGCGGTGCGAGTGACCAGTGCGGGCACCGGGAACTGGCATGTAGGCAGTTGCGCCGACGAGCGGGCGGCCGGGGTGTTGCGAGCCCACGGCTACCCTACCGACCACCGGGCCGCACAAGTCGGCACCGAACACCTGGCGGCAGACCTGTTGGTGGCCTTGGACCGCAACCACGCTCGGCTGTTGCGGCAGCTCGGCGTCGAAGCCGCCCGGGTACGGATGCTGCGGTCATTCGACCCACGCTCGGGAACCCATGCGCTCGATGTCGAGGATCCCTACTATGGCGATCACTCCGACTTCGAGGAGGTCTTCGCCGTCATCGAATCCGCCCTGCCCGGCCTGCACGACTGGGTCGACGAACGTCTCGCGCGGAACGGACCGAGTTGA

*GC% Content for gene: 66.06%

*CDS Gene Sequence (codon optimized) - copy from output of Primer Design Protocol (paste as text only):

*GC% Content for gene (codon optimized):

Primer design results for 'tail' primers (this is just 2 sequences):